General Information

  • ID:  hor004600
  • Uniprot ID:  Q9W7M8
  • Protein name:  Thymosin beta
  • Gene name:  tmsb
  • Organism:  Danio rerio (Zebrafish) (Brachydanio rerio)
  • Family:  Thymosin beta family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Danio (genus), Danioninae (subfamily), Danionidae (family), Cyprinoidei (suborder), Cypriniformes (order), Cypriniphysae (superorder), Otophysi, Ostariophysi (subcohort), Otomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0003779 actin binding; GO:0003785 actin monomer binding
  • GO BP:  GO:0007015 actin filament organization; GO:0030334 regulation of cell migration; GO:0042989 sequestering of actin monomers; GO:0043152 induction of bacterial agglutination; GO:0106014 regulation of inflammatory response to wounding
  • GO CC:  GO:0005737 cytoplasm; GO:0005856 cytoskeleton

Sequence Information

  • Sequence:  ADKPNMTEITSFDKTKLRKTETQEKNPLPTKETIEQERQGESTP
  • Length:  44(2-45)
  • Propeptide:  MADKPNMTEITSFDKTKLRKTETQEKNPLPTKETIEQERQGESTP
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Plays an important role in the organization of the cytoskeleton.
  • Mechanism:  Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization
  • Cross BBB:  NA
  • Target:  actb1
  • Target Unid:  Q7ZVI7
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q9W7M8-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor004600_AF2.pdbhor004600_ESM.pdb

Physical Information

Mass: 584375 Formula: C215H357N61O78S
Absent amino acids: CHVWY Common amino acids: T
pI: 4.98 Basic residues: 8
Polar residues: 13 Hydrophobic residues: 6
Hydrophobicity: -164.32 Boman Index: -15775
Half-Life: 4.4 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 37.73
Instability Index: 5216.82 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  10068630
  • Title:  Beta-Thymosin Is Required for Axonal Tract Formation in Developing Zebrafish Brain
  • PubMed ID:  23820300
  • Title:  Thymosin 尾4-sulfoxide Attenuates Inflammatory Cell Infiltration and Promotes Cardiac Wound Healing
  • PubMed ID:  23820300
  • Title:   Thymosin Participates in Antimicrobial Immunity in Zebrafish